CJC-1295 2mg/vials Lyophilized Peptides Powder

​CJC-1295 2mg Vials Lyophilized Peptides CAS 863288-34-0 for Enhancement
Product Name: CJC1295
CAS: 863288-34-0
MF: C159H258N46O45
Chat Now
Product Details

CJC-1295 2mg Vials Lyophilized Peptides CAS 863288-34-0 for Enhancement

Product Name: CJC1295
Synonyms:CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;L-Tyrosyl-D-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-allothreonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl
CAS: 863288-34-0
MF: C159H258N46O45


How to use CJC-1295?

CJC 1295 is typically provided in vials containing 2 or 5 mg of lyophylized powder, though the amount can vary. The contents should be reconstituted by adding a convenient amount of sterile or bacteriostatic water. If for example 2 mL is chosen and the dosing of the vial is 2 mg, the resulting solution then has a concentration of 1 mg/mL, or 1000 mcg/mL.

At time of dosing, an insulin syringe is used to draw and then inject the desired amount. In the above example, a 1000 mcg dose would require a volume of 1 mL, or “100 IU” as marked on an insulin syringe. 


Injection may be subcutaneous, intramuscular, or intravenous according to personal preference. If desired, peptide solutions from other vials, such as a vial of a GHRP product, may also be drawn into the same syringe, if there is room. This reduces the total number of injections required.

When recommending CJC 1295, I ordinarily recommend a dosage of 1000 mcg at a time, twice per week.


CJC-1295 without DAC Application:

CJC 1295's main function upon creation was found to boost protein synthesis, increased growth of muscle tissue and many other benefits come with it as well. CJC 1295 also helps injury recovery times, reduce body fat, boost immune system and bone density and cellular repair (skin and organs).


MGF, 2mg

PEG MGF, 2mg

CJC-1295 DAC, 2mg

CJC-1295, 2mg

PT141, 10mg

Melanotan-2, 10mg

GHRP-2, 10mg

GHRP-6, 10mg

GHRP-2, 5mg

GHRP-6, 5mg

Ipamorelin, 2mg

Hexarelin, 2mg

Sermorelin, 2mg

Oxytocin, 2mg

TB500, 2mg

HGH 176-191, 2mg

Triptorelin, 2mg

Tesamorelin, 2mg

Gonadorelin, 2mg

Gonadorelin, 10mg

DSIP, 2mg

Selank, 5mg

BPC 157, 2mg

Epitalon, 10mg

Follistatin 344, 1mg

AOD-9604, 2mg

Deslorelin, 20mg

IGF-1 LR3, 0.1mg

Follistatin 315, 1mg

Dermorphin, 10mg

Thymosin α1 Acetate, 10mg

ACE 031, 1mg

GDF-8, 1mg


图片15.jpg

Hot Tags: CJC-1295 2mg/vials lyophilized peptides powder, China, suppliers, discount, buy, bulk, pricelist, high quality, in stock
Feedback