Peptides 2MG Sermorelin for Weight Loss

Sermorelin CAS 86168-78-7 Sermorelin Acetate 2MG for Weight Loss
Product Name: Sermorelin
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
Chat Now
Product Details

Sermorelin CAS 86168-78-7 Sermorelin Acetate 2MG for Weight Loss

Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88 


Usage xanthine oxidase inhibitor

Sermorelin Applications:

- Increases the development of lean body mass through the development of new muscle cells
- Reduces body fat through lipolysis
- Increases energy and vitality
- Increases strength
- Increases endurance
- Accelerates healing from wounds or surgery
- Strengthens the heart
- Enhances the immune system
- Increases IGF-1 production
- Improves sleep quality
- Increases calcium retention, and strengthens and increases the mineralization of bone or bone density.
- Increases protein synthesis and stimulates the growth of all internal organs except the brain.


The Sermorelin Acetate Peptide and HGH

Sermorelin Acetate, which shares similar structure to CJC-1295, is a bio-identical synthetic hormone that is extremely effective in increasing the amount of HGH. Human Growth Hormone is a hormone released by the body that controls the reproduction and growth of the cells and each of the organs in the body. At a young age, the body's HGH production is most active while the growth rate is at its highest point. After the age of 30, for every decade of life, there is a 14% reduction in HGH production . By the age of 40, HGH production is about 40 percent of what it was at the age of 20. With the further development of Growth Hormone Releasing Factors (GHRF), such as Modified GRF 1-29, HGH production may possibly begin again by stimulating the pituitary gland.


MGF, 2mg

PEG MGF, 2mg

CJC-1295 DAC, 2mg

CJC-1295, 2mg

PT141, 10mg

Melanotan-2, 10mg

GHRP-2, 10mg

GHRP-6, 10mg

GHRP-2, 5mg

GHRP-6, 5mg

Ipamorelin, 2mg

Hexarelin, 2mg

Sermorelin, 2mg

Oxytocin, 2mg

TB500, 2mg

HGH 176-191, 2mg

Triptorelin, 2mg

Tesamorelin, 2mg

Gonadorelin, 2mg

Gonadorelin, 10mg

DSIP, 2mg

Selank, 5mg

BPC 157, 2mg

Epitalon, 10mg

Follistatin 344, 1mg

AOD-9604, 2mg

Deslorelin, 20mg

IGF-1 LR3, 0.1mg

Follistatin 315, 1mg

Dermorphin, 10mg

Thymosin α1 Acetate, 10mg

ACE 031, 1mg

GDF-8, 1mg


图片23.jpg

Hot Tags: peptides 2mg sermorelin for weight loss, China, suppliers, discount, buy, bulk, pricelist, high quality, in stock
Feedback